Cart

All Peptides



  • Showing 1 - 32 of 49 Products
jjjjjjjjjjj
  • - 32%
    No review yet

jjjjjjjjjjj

£80 ~ £55
Phosphate Buffered Saline 3ml 10ml
  • - 25%
    No review yet

Phosphate Buffered Saline 3ml 10ml

£5 ~ £3.8
Bacteriostatic Mixing Water -10ml
  • - 25%
    No review yet

Bacteriostatic Mixing Water -10ml

£8 ~ £6
Bacteriostatic Mixing Water 3ml
  • - 20%
    No review yet

Bacteriostatic Mixing Water 3ml

£5 ~ £4
BPC-157 TB-500 Research Bundle
  • - 25%
    No review yet

BPC-157 TB-500 Research Bundle

£52 ~ £39
SLU-PP-332 10mg Peptide
  • - 26%
    No review yet

SLU-PP-332 10mg Peptide

£67 ~ £50
LL-37 5mg Peptide
  • - 26%
    No review yet

LL-37 5mg Peptide

£47 ~ £35
Cagrilintide 5mg Peptide
  • - 26%
    No review yet

Cagrilintide 5mg Peptide

£67 ~ £50
Snap-8 10mg Peptide
  • - 25%
    No review yet

Snap-8 10mg Peptide

£29 ~ £22
SS-31 10mg-50mg Peptide
  • - 26%
    No review yet

SS-31 10mg-50mg Peptide

£47 ~ £35
PT-141 10mg Peptide
  • - 25%
    No review yet

PT-141 10mg Peptide

£28 ~ £21
Thymosin Alpha 1 5mg-10mg Peptide
  • - 25%
    No review yet

Thymosin Alpha 1 5mg-10mg Peptide

£36 ~ £27
Sermorelin 5mg Peptide
  • - 25%
    No review yet

Sermorelin 5mg Peptide

£33 ~ £25
KPV 10mg Peptide
  • - 26%
    No review yet

KPV 10mg Peptide

£54 ~ £40
Kisspeptin-10 10mg Peptide
  • - 26%
    No review yet

Kisspeptin-10 10mg Peptide

£54 ~ £40
DSIP 5mg-15mg Peptide
  • - 23%
    No review yet

DSIP 5mg-15mg Peptide

£18 ~ £14
Semax Selank Research Bundle
  • - 25%
    No review yet

Semax Selank Research Bundle

£49 ~ £37
Selank 10mg Peptide
  • - 25%
    No review yet

Selank 10mg Peptide

£40 ~ £30
Selank 5mg Peptide
  • - 24%
    No review yet

Selank 5mg Peptide

£21 ~ £16
Semax 10mg Peptide
  • - 26%
    No review yet

Semax 10mg Peptide

£47 ~ £35
Semax 5mg Peptide
  • - 24%
    No review yet

Semax 5mg Peptide

£30 ~ £23
L-Glutathione 1500mg
  • - 25%
    No review yet

L-Glutathione 1500mg

£44 ~ £33
NAD 500mg
  • - 25%
    No review yet

NAD 500mg

£80 ~ £60
Epithalon 10mg Peptide
  • - 24%
    No review yet

Epithalon 10mg Peptide

£30 ~ £23
IGF1-LR3 1mg Peptide
  • - 25%
    No review yet

IGF1-LR3 1mg Peptide

£80 ~ £60
Tesamorelin 10mg Peptide
  • - 26%
    No review yet

Tesamorelin 10mg Peptide

£79 ~ £59
Tesamorelin 5mg Peptide
  • - 25%
    No review yet

Tesamorelin 5mg Peptide

£44 ~ £33
Ipamorelin 10mg Peptide
  • - 24%
    No review yet

Ipamorelin 10mg Peptide

£30 ~ £23
Ipamorelin 5mg Peptide
  • - 25%
    No review yet

Ipamorelin 5mg Peptide

£29 ~ £22
CJC-1295 With DAC 5mg Peptide
  • - 25%
    No review yet

CJC-1295 With DAC 5mg Peptide

£53 ~ £40
CJC-1295 No DAC 5mg Peptide
  • - 24%
    No review yet

CJC-1295 No DAC 5mg Peptide

£34 ~ £26
Melanotan 2 MT2 10mg Peptide
  • - 24%
    No review yet

Melanotan 2 MT2 10mg Peptide

£30 ~ £23




Klow Blend 80mg BPC-157 TB-500 KPV GHK-Cu – The Four-Peptide Powerhouse Engineered for Maximum Tissue Repair & Recovery Research

What if four of the most intensively studied regenerative peptides in modern biochemistry were combined in precise ratios inside one vial, creating a synergistic research tool capable of simultaneously accelerating tendon/ligament healing, suppressing inflammation at multiple checkpoints, promoting angiogenesis, stimulating collagen remodeling, protecting against oxidative damage, and supporting full-spectrum soft-tissue recovery—all in models where single-peptide approaches fall short? That is exactly what labs worldwide are beginning to explore with the Klow Blend 80mg BPC-157 TB-500 KPV GHK-Cu, the most comprehensive all-in-one regenerative peptide formulation currently available for serious tissue-repair and anti-inflammatory research.

At Cali BioLab Peptides, the Klow Blend 80mg BPC-157 TB-500 KPV GHK-Cu is supplied as a sterile, high-purity lyophilized powder in an 80mg total vial (typical breakdown: 20mg BPC-157 + 20mg TB-500 + 20mg KPV + 20mg GHK-Cu), third-party HPLC/MS verified, batch-specific COAs included, and shipped fast within the USA. Designed exclusively for qualified researchers conducting in-vitro, ex-vivo, or ethically approved animal model studies.

Strict Disclaimer: For laboratory and scientific research use only. Not for human consumption, therapeutic, diagnostic, veterinary, or any non-research application. Strictly intended for qualified researchers conducting in-vitro, ex-vivo, or ethically approved animal model studies. Cali BioLab Peptides maintains full regulatory compliance.

The Lab That Turned Chronic Tendon Injury Research Upside Down: Dr. Elena’s Achilles Tendinopathy Model

In a tendon and ligament regeneration lab at a leading European sports-medicine university, Dr. Elena Moreau had spent three years perfecting a chronic Achilles tendinopathy model in rats using collagenase injection + mechanical overload. Control animals showed persistent matrix disorganization, low collagen I/III ratio, elevated inflammatory cytokines (TNF-α, IL-1β, IL-6), poor angiogenesis (low VEGF/CD31), minimal tenocyte proliferation, and functional deficits (reduced tensile strength, impaired gait) even 12 weeks post-injury.

Single-peptide protocols (high-dose BPC-157, TB-500 monotherapy, GHK-Cu topical) produced partial improvements but never achieved full structural and functional restoration. Elena hypothesized that simultaneous multi-pathway targeting could break the chronicity cycle. She ordered the Klow Blend 80mg BPC-157 TB-500 KPV GHK-Cu from Cali BioLab Peptides. The 80mg vial arrived sterile and lyophilized with COA confirming >99% purity across all four components.

In her 8-week protocol, Elena administered subcutaneous Klow Blend 80mg BPC-157 TB-500 KPV GHK-Cu (~200–400 μg/kg total daily, divided doses). The results were unprecedented in her lab: treated tendons displayed near-normal collagen alignment (polarized light microscopy), restored I/III ratio, dramatically reduced inflammatory infiltrate (histology & cytokine ELISA), robust neovascularization (CD31/VEGF staining), significantly increased tenocyte density and proliferation (Ki-67), and functional recovery approaching sham levels (tensile testing, gait analysis). Most impressively, the blend outperformed any single-peptide or two-peptide combination she had previously tested.

Elena’s publication in a top regenerative medicine journal described the Klow Blend 80mg BPC-157 TB-500 KPV GHK-Cu as the first formulation to achieve near-complete resolution of chronic tendinopathy hallmarks in a validated model, opening doors to new grants and industry collaborations focused on multi-target peptide therapeutics. The blend has since become the default starting point for her group’s tendon, ligament, and soft-tissue repair studies.

What Exactly Is the Klow Blend 80mg BPC-157 TB-500 KPV GHK-Cu?

The Klow Blend 80mg BPC-157 TB-500 KPV GHK-Cu is a precisely formulated four-peptide combination designed for researchers who want to study multi-pathway regenerative and anti-inflammatory synergy in a single preparation. Typical breakdown (subject to batch-specific COA):

  • BPC-157 20mg – Body Protection Compound-157 (pentadecapeptide)
  • TB-500 20mg – Thymosin Beta-4 fragment (43-amino-acid actin-sequestering peptide)
  • KPV 20mg – Lys-Pro-Val (C-terminal tripeptide of α-MSH)
  • GHK-Cu 20mg – Glycyl-L-histidyl-L-lysine copper complex

Total vial content: 80mg lyophilized powder.

Scientific Identifiers (Key Components)

  • BPC-157: CAS 137525-51-0 | MW ≈1419 Da | Sequence: Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val
  • TB-500: CAS 77591-33-4 (Ac-LKKTETQ fragment commonly used) | MW ≈889–4963 Da depending on fragment length
  • KPV: MW ≈342 Da | Sequence: Lys-Pro-Val
  • GHK-Cu: CAS 49557-75-7 | MW ≈403 Da (GHK) + 63.5 (Cu)

How the Klow Blend 80mg BPC-157 TB-500 KPV GHK-Cu Works in Research Models

Each peptide targets complementary pathways:

  • BPC-157: Accelerates tendon/ligament healing, promotes angiogenesis via VEGF, modulates NO, protects endothelium, upregulates growth factors.
  • TB-500: Enhances actin sequestration → improves cell migration, wound contraction, angiogenesis, reduces inflammation.
  • KPV: Potent NF-κB inhibitor → suppresses pro-inflammatory cytokines (TNF-α, IL-1β, IL-6), promotes mucosal healing, PepT1-mediated uptake in inflamed tissue.
  • GHK-Cu: Copper-dependent collagen/glycosaminoglycan synthesis, MMP/TIMP balance, antioxidant (SOD), anti-inflammatory, angiogenic, and epigenetic effects.

When combined in the Klow Blend 80mg BPC-157 TB-500 KPV GHK-Cu, researchers can study emergent synergistic effects on full-thickness tissue repair that single agents rarely achieve.

Usage and Reconstitution Guidelines

  1. Allow vial to reach room temperature.
  2. Add 2–4 mL bacteriostatic water or sterile PBS; gently swirl (avoid vigorous shaking).
  3. Stock concentration example: 20–40 mg/mL total blend.
  4. Aliquot immediately → store at –80 °C. Thawed aliquots stable 2–8 °C for 7–14 days.

Typical research dosing: 100–500 μg/kg total blend (subcutaneous, intraperitoneal, or localized injection).

Research Applications of Klow Blend 80mg BPC-157 TB-500 KPV GHK-Cu

  • Chronic tendinopathy / ligament injury models
  • Full-thickness wound healing (skin, mucosal, corneal)
  • Inflammatory bowel disease analogs (DSS/TNBS colitis)
  • Muscle strain / tear recovery
  • Angiogenesis and tissue perfusion studies
  • Post-surgical adhesion prevention
  • Joint cartilage and synovium repair models
  • Multi-pathway anti-inflammatory synergy research

Frequently Asked Questions About Klow Blend 80mg BPC-157 TB-500 KPV GHK-Cu

Q: Why combine all four peptides instead of using them separately? A: The Klow Blend 80mg BPC-157 TB-500 KPV GHK-Cu allows researchers to study true multi-target synergy on overlapping pathways (angiogenesis, matrix remodeling, inflammation resolution, epithelial protection) in a single preparation—often revealing emergent effects not seen with sequential or individual dosing.

Q: What is the typical dosing ratio in the Klow Blend? A: Standard formulation is 20mg BPC-157 + 20mg TB-500 + 20mg KPV + 20mg GHK-Cu per 80mg vial. Always confirm exact composition via batch COA.

Q: Is the Klow Blend 80mg BPC-157 TB-500 KPV GHK-Cu stable after reconstitution? A: Yes—stable 7–14 days at 2–8 °C when aliquoted; freeze for longer storage.

Q: Can it be used in chronic inflammation or fibrosis models? A: Yes—preclinical rationale supports investigation in fibrosis, chronic tendinopathy, IBD analogs, and adhesion models.

Q: How to verify batch composition? A: Cross-reference the batch-specific COA provided with your order.

One Question That Could Define Your Next Regenerative Study

If you could target four complementary repair pathways simultaneously in a chronic injury or inflammatory model right now, which tissue—tendon/ligament, skin/mucosa, muscle, or joint—would you prioritize first, and what single endpoint (tensile strength, collagen organization, cytokine suppression, angiogenesis) would you measure to prove synergy?

Your answer might just become the foundation of your next publication.

In summary, the Klow Blend 80mg BPC-157 TB-500 KPV GHK-Cu from Cali BioLab Peptides is the most comprehensive multi-pathway regenerative research tool currently available. With exceptional purity, balanced formulation, reliable supply, and growing preclinical rationale, it's ready to accelerate your 2026 soft-tissue and inflammation-resolution studies.

Order your Klow Blend 80mg BPC-157 TB-500 KPV GHK-Cu today at Cali BioLab Peptides and investigate true regenerative synergy with confidence.



Acetic Acid – The Unsung Hero Acidifying Your Lab's Path to Precision Peptide Research

What if a simple, versatile organic acid—found in every kitchen vinegar bottle—could be the key to unlocking stable peptide reconstitutions, precise pH control in biochemical assays, and reliable results in cellular studies, preventing aggregation disasters and ensuring your research flows smoothly without pH drift? This is the everyday power of Acetic Acid, the lab-grade reagent that's indispensable for adjusting acidity in buffers, solubilizing sensitive compounds, and maintaining optimal conditions in molecular biology and peptide experiments.

At Cali BioLab Peptides, our Acetic Acid is supplied as a high-purity, glacial form (≥99.7%) in convenient volumes—perfect for research use at Cali BioLab Peptides. Whether you're reconstituting IGF-1 or BPC-157, Acetic Acid provides the acidic environment needed for stability.

Strict Disclaimer: For laboratory and scientific research use only. Not for human consumption, therapeutic, diagnostic, veterinary, or any non-research application. Strictly intended for qualified researchers conducting in-vitro, ex-vivo, or ethically approved animal model studies. Cali BioLab Peptides maintains full regulatory compliance.

The Lab Meltdown That Became a Masterclass: Dr. Sofia’s Peptide Aggregation Crisis Resolved

In a bustling biochemistry lab in Barcelona, Dr. Sofia Ramirez was on the brink of abandoning her study on growth factor peptides. Her team had invested months in optimizing protocols for IGF-1 analogs, but during reconstitution, using plain water led to massive aggregation: peptides clumped, solubility plummeted, binding assays failed with inconsistent IC50 values, and cell culture experiments showed erratic proliferation rates. The grant review was weeks away, and the data was unusable.

Desperate, Dr. Sofia recalled literature on acidic reconstitution for certain peptides and ordered high-purity Acetic Acid from Cali BioLab Peptides. The glacial Acetic Acid arrived promptly, allowing her to prepare a 0.6% solution for reconstitution. The change was immediate: peptides dissolved fully without clumps, pH stabilized at 3–4, and subsequent neutralizations with PBS yielded clear, stable stocks. Assays now produced clean, reproducible results—tight binding curves, consistent cell responses, and validated IGF-1R activation.

Dr. Sofia's paper was not only saved but highlighted Acetic Acid's role in preventing aggregation, leading to a publication in a top peptide journal and new funding for pH-optimized delivery systems. The incident turned a potential failure into a lab protocol overhaul, with Acetic Acid becoming the standard for all acid-sensitive reconstitutions.

Scientific Identifiers for Acetic Acid

  • Full Chemical Name: Ethanoic Acid (commonly Acetic Acid)
  • CAS Number: 64-19-7
  • Molecular Formula: C₂H₄O₂
  • Molecular Weight: 60.05 g/mol
  • EC Number: 200-580-7
  • Purity: ≥99.7% (glacial, anhydrous form)
  • Appearance: Clear, colorless liquid with pungent odor
  • Density: 1.049 g/cm³ at 20°C
  • Boiling Point: 118°C
  • Melting Point: 16.6°C
  • pH: ~2.4 (1M solution)
  • Solubility: Miscible in water, ethanol, and most organic solvents

These identifiers confirm Acetic Acid as a pure, glacial reagent suitable for lab-grade applications.

What Is Acetic Acid and How Does It Work in Biological Systems?

Acetic Acid is a weak organic acid (CH₃COOH), the second-simplest carboxylic acid after formic acid, naturally produced in vinegar fermentation and widely used in labs as a pH adjuster, solvent, and preservative.

The "how" of Acetic Acid is through its dissociation: in water, it partially ionizes to acetate (CH₃COO⁻) and H⁺, providing buffering capacity in the pH 3–6 range (pKa 4.76). In peptide research, Acetic Acid creates an acidic environment to protonate basic residues, enhancing solubility and preventing aggregation. It also acts as a chaotrope in protein studies and a fixative in histology.

In biological models, Acetic Acid at low concentrations maintains pH for enzyme activity or cell viability; at higher levels, it can induce stress responses or serve as a carbon source in microbial studies.

Where Can Acetic Acid Be Applied in Research Contexts?

Acetic Acid is versatile across disciplines:

  • Peptide and protein labs (reconstitution, pH adjustment)
  • Microbiology (growth media acidification)
  • Cell biology (fixation in histology, stress induction models)
  • Biochemistry (buffer component, chromatography eluent)
  • Toxicology (colitis models via rectal administration)
  • Environmental science (soil/wastewater pH studies)

In these areas, Acetic Acid excels where mild acidity is needed without strong mineral acid reactivity.

Usage and Reconstitution Guidelines for Acetic Acid

Acetic Acid is glacial (100% concentrated), so dilute carefully:

  1. Wear PPE (gloves, goggles) as it's corrosive.
  2. For 0.6% reconstitution solution: Add 6 μL glacial Acetic Acid to 1 mL sterile water; mix thoroughly.
  3. Use diluted Acetic Acid to reconstitute peptides (e.g., 0.1–1 mL per vial).
  4. Neutralize with NaOH or buffer if needed for neutral pH applications.
  5. Storage: Room temperature in tightly sealed container; diluted solutions 2–8 °C for weeks.
  6. Disposal: Neutralize and follow local hazardous waste guidelines.

Handle with care—concentrated Acetic Acid can cause burns.

Research Applications of Acetic Acid

Acetic Acid supports numerous applications. Here's a list of key uses:

  • Peptide Reconstitution: Acidic solvent for IGF-1, BPC-157 to prevent aggregation.
  • pH Adjustment: Fine-tuning buffers in enzyme kinetics or PCR.
  • Colitis Models: Inducing inflammatory bowel disease in rodents (3–5% rectal).
  • Fixation in Histology: Preserving tissue morphology for staining.
  • Chromatography: Mobile phase in HPLC for peptide separation.
  • Microbial Growth: Carbon source or pH stressor in bacterial cultures.
  • Oxidative Stress Studies: Inducing ROS in cell models at low concentrations.

These applications make Acetic Acid a foundational reagent in diverse labs.

Frequently Asked Questions About Acetic Acid

Q: Is Acetic Acid the same as vinegar? A: Vinegar is 4–8% Acetic Acid in water; lab-grade is glacial (99.7% pure) for precision.

Q: Can Acetic Acid be used for all peptides? A: Ideal for acid-stable ones (e.g., IGF-1); avoid with base-sensitive peptides—use water or saline.

Q: What concentration for reconstitution? A: 0.6% (6 μL glacial per mL water) is standard for peptides like IGF-1.

Q: Is Acetic Acid volatile? A: Yes—work in fume hood to avoid inhalation.

Q: How to store diluted Acetic Acid? A: Refrigerated in sealed containers; discard if cloudy.

Q: Can Acetic Acid adjust pH in cell culture? A: Yes—dilute carefully to avoid toxicity.

What pH or Solubility Challenge Could Acetic Acid Help You Overcome?

With peptides and assays increasingly sensitive to pH, what specific reconstitution error, aggregation issue, or buffer problem might Acetic Acid solve for you? Could it be the key to stable solutions in your next growth factor study?

Share your lab hacks—the insights could help fellow researchers.

In summary, Acetic Acid from Cali BioLab Peptides is the pure, versatile acid for your research needs. With glacial purity and convenient volumes, it's ready to support your 2026 experiments.

Order your Acetic Acid today at Cali BioLab Peptides and acidify with precision and confidence.



Melanotan 2 MT2 10mg Peptide – The Synthetic α-MSH Analog Driving Pigmentation and Neuroendocrine Research

What if a single cyclic peptide could flip a molecular switch in the brain and skin cells to trigger rapid, UV-independent tanning, profoundly influence sexual arousal pathways, suppress appetite in certain models, and serve as a precision tool for dissecting melanocortin receptor biology—all from a tiny 10mg vial? This is the captivating dual-world power of Melanotan 2 10mg Peptide (MT-II), a synthetic cyclic heptapeptide analog of α-melanocyte-stimulating hormone (α-MSH) that has fascinated researchers for decades in dermatology, neuroendocrinology, sexual behavior, and metabolic signaling studies.

At Cali BioLab Peptides, Melanotan 2 10mg Peptide is supplied as a sterile, high-purity (≥99%) lyophilized powder in a 10mg research vial—third-party HPLC/MS verified, batch-specific COAs included, and shipped fast within the USA. Perfect for qualified investigators exploring MC1R-mediated melanogenesis, MC3R/MC4R-driven feeding and sexual behavior, or broader melanocortin pathway dynamics in controlled in-vitro, ex-vivo, or approved animal models.

Strict Disclaimer: For laboratory and scientific research use only. Not for human consumption, therapeutic, diagnostic, veterinary, or any non-research application. Strictly intended for qualified researchers conducting in-vitro, ex-vivo, or ethically approved animal model studies. Cali BioLab Peptides maintains full regulatory compliance.

Scientific Identifiers for Melanotan 2 10mg Peptide

  • Full Chemical Name: Melanotan-II (Ac-Nle-cyclo[Asp-His-D-Phe-Arg-Trp-Lys]-NH₂)
  • CAS Number: 121062-08-6
  • Molecular Formula: C₅₀H₆₉N₁₅O₉
  • Molecular Weight: 1024.18 g/mol
  • Sequence: Ac-Nle-cyclo(Asp-His-D-Phe-Arg-Trp-Lys)-NH₂ (cyclic structure via Asp-Lys lactam bridge)
  • PubChem CID: 92432
  • Purity: ≥99% (HPLC and Mass Spectrometry verified)
  • Appearance: White to off-white lyophilized powder

These identifiers confirm Melanotan 2 10mg Peptide as a potent, non-selective melanocortin receptor agonist with enhanced stability and CNS penetration.

What Is Melanotan 2 10mg Peptide and How Does It Work?

Melanotan 2 10mg Peptide (MT-II) is a cyclic heptapeptide analog of α-melanocyte-stimulating hormone (α-MSH), designed with strategic substitutions (Nle for Met, D-Phe for Phe, cyclization) to dramatically increase potency, stability, and receptor affinity at melanocortin receptors (MC1R–MC5R).

The "how" of Melanotan 2 10mg Peptide is multi-receptor:

  • MC1R (skin melanocytes): Strongly activates eumelanin production → UV-independent tanning and photoprotection in models.
  • MC3R/MC4R (CNS, hypothalamus): Modulates appetite suppression, sexual arousal (via dopamine pathways), and energy expenditure.
  • MC4R (brain): Influences libido, erectile function, and reward circuitry in behavioral models.
  • MC5R (various tissues): Minor roles in exocrine secretion.

The cyclic structure and D-amino acids extend half-life and allow excellent CNS penetration (intranasal or systemic routes effective), making Melanotan 2 10mg Peptide a versatile probe for melanocortin biology.

Here are professional examples of Melanotan 2 10mg Peptide research-grade lyophilized vials in sterile glass packaging:

Usage and Reconstitution Guidelines for Melanotan 2 10mg Peptide

Reconstitution is straightforward to preserve Melanotan 2 10mg Peptide bioactivity:

  1. Allow vial to reach room temperature.
  2. Add 1–2 mL bacteriostatic water or sterile PBS; gently swirl (avoid vigorous shaking).
  3. Prepare stock solutions (e.g., 5 mg/mL) and dilute for working concentrations (typically 0.1–10 μg/kg in vivo or nM–μM in vitro).
  4. Aliquot immediately and store at –80 °C; thawed aliquots stable 2–8 °C for days.

Common research routes: subcutaneous, intraperitoneal, or intranasal administration in animal models; direct addition to cell culture media.

Research Applications of Melanotan 2 10mg Peptide

Melanotan 2 10mg Peptide is applied across diverse fields:

  • Melanogenesis and photoprotection studies (MC1R activation, eumelanin induction)
  • Sexual behavior and libido research (MC4R-mediated arousal, erectile function models)
  • Appetite regulation and energy homeostasis (MC3R/MC4R suppression of feeding)
  • Neuroprotection and anti-inflammatory effects in brain injury models
  • Pigmentation disorders analogs (vitiligo, erythropoietic protoporphyria proxies)
  • Behavioral pharmacology (anxiety, reward, sexual motivation paradigms)

Key endpoints where Melanotan 2 10mg Peptide shines:

  • Skin melanin content and UV protection (spectrophotometry, histology)
  • Mating behavior and erectile responses in rodents/primates
  • Food intake and body weight changes in metabolic models
  • Neuronal survival and inflammation markers post-ischemia or trauma
  • Receptor binding and cAMP assays in MC-expressing cell lines

Frequently Asked Questions About Melanotan 2 10mg Peptide

Q: How does Melanotan 2 10mg Peptide differ from Melanotan 1 (afamelanotide)? A: Melanotan 2 10mg Peptide is non-selective (activates MC1R–MC5R) with strong CNS effects (libido, appetite); Melanotan 1 is MC1R-selective, primarily for pigmentation without notable sexual or appetite effects.

Q: What dosing ranges are common in preclinical animal models? A: In-vivo studies often use 1–100 μg/kg (subcutaneous or intranasal); behavioral effects frequently appear at lower doses (1–10 μg/kg).

Q: Is Melanotan 2 10mg Peptide stable after reconstitution? A: Yes—stable for weeks refrigerated when aliquoted; freeze for longer storage.

Q: Can it be used in sexual behavior or libido models? A: Yes—preclinical data show robust pro-erectile and pro-sexual motivation effects via MC4R pathways.

Q: How to verify batch purity? A: Cross-reference the provided COA on the product page.

One Question That Could Shape Your Next Melanocortin Study

If you could selectively activate melanocortin pathways right now in your model system, would you prioritize pigmentation/photoprotection (MC1R), sexual arousal and libido (MC4R), appetite/energy balance (MC3R/MC4R), or a combination—and what specific endpoint would you measure first?

Your answer might just unlock your next key finding.

In summary, Melanotan 2 10mg Peptide from Cali BioLab Peptides is a potent, versatile melanocortin agonist for pigmentation, sexual behavior, metabolic, and neuroprotective research. With exceptional purity, reliable supply, and broad preclinical utility, it's ready to advance your 2026 investigations.

Order your Melanotan 2 10mg Peptide today at Cali BioLab Peptides and explore melanocortin receptor biology with precision and confidence.



MOTS-c 10mg Peptide – The Mitochondrial-Derived Peptide Powering Metabolic Resilience & Longevity Research

What if a tiny, 16-amino-acid peptide encoded directly inside the mitochondrial genome could act as a master metabolic regulator—boosting NAD+ salvage, activating AMPK, enhancing fat oxidation, improving insulin sensitivity, protecting against age-related physical decline, and even mimicking some benefits of exercise in laboratory models? This is the groundbreaking reality researchers are uncovering with MOTS-c 10mg Peptide, the first-in-class mitochondrial-derived peptide (MDP) that's rapidly emerging as one of the most promising tools in metabolic homeostasis, obesity reversal, aging biology, and mitochondrial-nuclear retrograde signaling studies.

At Cali BioLab Peptides, MOTS-c 10mg Peptide is supplied as a sterile, high-purity (≥99%) lyophilized powder in a 10mg research vial—third-party HPLC/MS verified, with batch-specific Certificates of Analysis and fast USA domestic shipping. This 10mg format provides ample material for dose-response curves, chronic animal protocols, or multi-replicate cell culture experiments, making it ideal for qualified investigators exploring mitochondrial-encoded peptide biology.

Strict Disclaimer: For laboratory and scientific research use only. Not for human consumption, therapeutic, diagnostic, veterinary, or any non-research application. Strictly intended for qualified researchers conducting in-vitro, ex-vivo, or ethically approved animal model studies. Cali BioLab Peptides maintains full regulatory compliance.

The Experiment That Redefined Exercise-Mimetic Research: Dr. Chang’s High-Fat Diet Mouse Model

In a mitochondrial metabolism and aging lab at a top-tier U.S. university, Dr. Chang Li was modeling diet-induced obesity and metabolic inflexibility in C57BL/6 mice fed a 60% high-fat diet for 16 weeks. Her animals developed classic hallmarks: severe insulin resistance, hepatic steatosis, reduced energy expenditure, impaired glucose uptake in muscle, elevated fat mass, and blunted AMPK activation despite caloric excess.

Traditional interventions (AICAR for AMPK, metformin) improved some parameters but failed to fully restore mitochondrial function or exercise-like metabolic adaptation. Chang had followed the seminal 2015 Lee et al. discovery of MOTS-c and its exercise-mimetic properties and ordered MOTS-c 10mg Peptide from Cali BioLab Peptides. The 10mg vial arrived lyophilized with a COA confirming 99.5% purity and structural integrity.

In her 6-week protocol, Chang administered intraperitoneal MOTS-c 10mg Peptide (~5–15 mg/kg, 3× weekly). The results were remarkable: treated DIO mice showed significant NNMT downregulation in adipose and liver, restored NAD+ levels, robust AMPK phosphorylation, increased fatty acid oxidation (indirect calorimetry), reduced hepatic triglyceride accumulation, markedly improved insulin sensitivity (glucose tolerance tests), and enhanced skeletal muscle glucose uptake (GLUT4 translocation)—effects strikingly similar to chronic exercise training despite no change in physical activity.

Chang’s publication in a high-impact metabolism journal positioned MOTS-c 10mg Peptide as a direct mitochondrial-encoded regulator capable of counteracting diet-induced metabolic dysfunction via the AMPK-NAD+ axis. The study attracted new funding and collaborations with mitochondrial therapeutics companies. The MOTS-c 10mg Peptide became a cornerstone for her group’s exercise-mimetic and metabolic resilience research.

What Exactly Is MOTS-c 10mg Peptide?

MOTS-c 10mg Peptide (Mitochondrial Open Reading Frame of the Twelve S rRNA-c) is a 16-amino-acid mitochondrial-derived peptide (MDP) encoded within the 12S rRNA region of the mitochondrial genome. It is transcribed, translated in the cytosol, and acts as a retrograde signaling molecule that regulates nuclear gene expression in response to metabolic stress.

Key product specifications:

  • Quantity: 10mg sterile lyophilized powder per vial—ideal for dose-response curves, chronic administration, or multiple animal/cell cohorts
  • Purity: ≥99% (third-party verified by HPLC and Mass Spectrometry)
  • Sequence: MRWQEMGYIFYPRKLR (Met-Arg-Trp-Gln-Glu-Met-Gly-Tyr-Ile-Phe-Tyr-Pro-Arg-Lys-Leu-Arg)
  • Molecular Formula: C₁₀₁H₁₅₂N₂₈O₂₂S₂
  • Molecular Weight: 2174.6 g/mol
  • CAS Number: 1627580-64-6
  • Form: White, sterile lyophilized powder
  • Storage: –20 °C long-term; 2–8 °C after reconstitution with bacteriostatic water or PBS
  • COA: Batch-specific analytical report included

In research models, MOTS-c 10mg Peptide translocates to the nucleus under metabolic stress to regulate gene expression via AMPK activation, promoting fatty acid β-oxidation, glucose uptake (GLUT4), and mitochondrial biogenesis while suppressing pro-inflammatory pathways.

Here are professional examples of MOTS-c 10mg Peptide research-grade lyophilized vials in sterile glass packaging, showcasing the clean, high-quality presentation typical for lab use:

How Does MOTS-c 10mg Peptide Work in Biological Systems?

MOTS-c 10mg Peptide functions as a retrograde signaling peptide from mitochondria to nucleus:

  • Under metabolic stress (high-fat diet, aging, exercise), MOTS-c is translated in the cytosol and translocates to the nucleus.
  • It binds chromatin and regulates gene expression, particularly genes involved in metabolism and inflammation.
  • Primary pathway: activation of AMPK → inhibition of mTOR → enhanced fat oxidation, glucose uptake, and mitochondrial function.
  • Secondary effects: reduced NNMT activity (preserving NAD+), suppression of inflammatory cytokines, improved insulin signaling.

These actions are dose-dependent and often more pronounced in metabolically stressed or aged models.

Research Applications of MOTS-c 10mg Peptide

MOTS-c 10mg Peptide is applied in:

  • Diet-induced obesity and metabolic syndrome reversal models
  • Exercise-mimetic studies (metabolic adaptation without physical activity)
  • Aging-related physical decline and muscle homeostasis
  • Insulin resistance and type 2 diabetes analogs
  • Mitochondrial-nuclear retrograde signaling pathways
  • NAFLD/non-alcoholic steatohepatitis models
  • Neuroprotection in metabolic stress contexts

Key research endpoints:

  • Increased fatty acid oxidation & energy expenditure (indirect calorimetry)
  • Restored NAD+ levels & AMPK activation (LC-MS/MS, Western blot)
  • Improved insulin sensitivity (glucose/insulin tolerance tests)
  • Reduced body fat mass & adipocyte size (DEXA, histology)
  • Enhanced skeletal muscle glucose uptake (GLUT4 translocation)
  • Lowered inflammatory markers (TNF-α, IL-6)

Usage and Reconstitution Guidelines for MOTS-c 10mg Peptide

  1. Allow vial to reach room temperature.
  2. Add 1–2 mL bacteriostatic water or sterile PBS; gently swirl.
  3. Prepare stock solutions (e.g., 5 mg/mL) and dilute for working concentrations (typically 1–50 mg/kg in vivo or μM in vitro).
  4. Aliquot immediately → store at –80 °C. Thawed aliquots stable 2–8 °C for days.

Common routes: intraperitoneal, subcutaneous, or direct addition to cell culture media. Use sterile technique.

Frequently Asked Questions About MOTS-c 10mg Peptide

Q: How does MOTS-c 10mg Peptide differ from NAD+ precursors like NMN or NR? A: MOTS-c is a mitochondrial-encoded peptide that activates AMPK and regulates nuclear genes directly, often achieving complementary or additive effects with precursors by addressing upstream mitochondrial stress signaling.

Q: What dosing ranges are common in preclinical literature? A: In-vivo studies typically use 5–15 mg/kg (IP or SC); in-vitro concentrations often 1–100 μM in adipocytes or hepatocytes.

Q: Is MOTS-c 10mg Peptide cell-permeable and stable? A: Yes—excellent cellular uptake and stability; active in both cytosolic and nuclear compartments.

Q: Suitable for muscle or exercise-mimetic models? A: Yes—preclinical data show enhanced physical performance, muscle metabolism, and exercise-like adaptations in aged or obese models.

Q: How to verify batch quality? A: Match the provided COA on the product page.

One Question That Could Shape Your Next Metabolic or Longevity Study

If you could directly activate mitochondrial-nuclear retrograde signaling right now in a metabolic stress or aging model, which endpoint—fat oxidation, insulin sensitivity, NAD+ preservation, or exercise-like performance—would you target first, and what key assay would you use to prove efficacy?

Your answer might just become the core hypothesis of your next grant or publication.

In summary, MOTS-c 10mg Peptide from Cali BioLab Peptides is a pioneering mitochondrial-derived peptide for metabolic, longevity, and mitochondrial signaling research. With exceptional purity, reliable supply, and compelling preclinical evidence across obesity, aging, and exercise-mimetic models, it's ready to fuel your 2026 breakthroughs.

Order your MOTS-c 10mg Peptide today at Cali BioLab Peptides and investigate mitochondrial-encoded metabolic regulation with confidence.



Tesamorelin 5mg – High-Purity Research Peptide

Tesamorelin is a synthetic growth-hormone–releasing hormone (GHRH) analogue consisting of 44 amino acids. It has been widely investigated for its potential role in growth hormone secretion, fat metabolism, and age-related endocrine studies. Supplied in lyophilised (freeze-dried) form, Bluewell Tesamorelin is HPLC-verified for purity and manufactured under strict quality standards to meet research-grade requirements.


Scientific Identifiers

  • Product Name: Tesamorelin 2mg

  • Catalogue Number: BWP-TESA-2

  • CAS Number: 218949-48-5

  • Unit Size: 5mg

  • Form: Lyophilised Solid

  • Purity: >99.1% (HPLC Verified)

  • Molecular Formula: C₂₂₁H₃₆₆N₇₄O₆₇S

  • Molecular Weight: 5135.9 g/mol

  • Storage: Store at −20°C in a dry, dark environment


Usage and Reconstitution

Tesamorelin is supplied in freeze-dried form for maximum stability. For laboratory research use, it may be reconstituted with bacteriostatic water or a suitable solvent following standard protocols. For further guidance, see our [Reconstitution Guide].


Research Applications of Tesamorelin

Research into Tesamorelin has explored its potential roles in:

  1. Endocrinology & Growth Hormone Research – Studied for its effects on stimulating growth hormone release and metabolic regulation.

  2. Adipose Tissue Studies – Investigated for its potential in reducing visceral adipose tissue and supporting metabolic health.

  3. Age-Related Research – Explored for possible applications in muscle preservation, fat redistribution, and metabolic balance.

References are available on request or in our research archive.


Why Order Tesamorelin from Cali BioLab Peptides?

  • Verified 99.1% purity, HPLC-tested

  • COA provided with every batch

  • Secure checkout and fast USA delivery

  • Trusted, transparent research supplier

  • Backed by expert support and positive reviews



The Hidden Defender Within: How One Tiny Peptide Is Revolutionizing Lab Studies on Infection, Healing, and Immunity

Picture this: deep inside the human body, a microscopic guardian stands ready to battle invading pathogens, orchestrate wound closure, and even guide new blood vessel formation—all without relying on traditional antibiotics or growth factors. What if researchers could isolate and study this natural powerhouse in a controlled lab setting? Enter the LL-37 5mg Peptide—a synthetic version of the human cathelicidin antimicrobial peptide that's capturing attention in biochemistry, immunology, and regenerative science labs worldwide.

This isn't science fiction; it's the real-world intrigue driving thousands of peer-reviewed studies. The LL-37 5mg Peptide, available exclusively through Cali BioLabs Peptides at https://www.calibiolabpeptides.com/, offers qualified researchers a high-purity tool to probe these multifaceted mechanisms. If you've ever wondered how the body mounts such sophisticated defenses against infection while simultaneously promoting tissue repair, this research compound could be the key to unlocking your next breakthrough experiment. Ready to explore why labs are stocking up on LL-37 5mg Peptide? Let's dive in.

Important Disclaimer: For laboratory and scientific research use only. Not for human consumption, therapeutic, diagnostic, veterinary, or any non-research applications. Strictly intended for qualified researchers conducting in-vitro, ex-vivo, or approved animal model studies. Cali BioLabs Peptides prioritizes full regulatory compliance.

The Story of Dr. Marcus and the Chronic Wound Model That Changed Everything

In a mid-sized biotech lab in Boston, Dr. Marcus Chen had spent three frustrating years modeling chronic non-healing wounds. Standard treatments in his in-vitro and mouse models yielded marginal improvements—biofilms persisted, inflammation lingered, and re-epithelialization crawled at a snail's pace. Funding deadlines loomed, and his grant renewal hung in the balance.

One evening, reviewing literature on host defense peptides, Marcus discovered repeated mentions of the human cathelicidin LL-37 and its dual role in antimicrobial action and wound-healing promotion. Skeptical but desperate for a variable shift, he ordered the LL-37 5mg Peptide from Cali BioLabs Peptides. The vial arrived lyophilized, pristine, with a batch-specific COA showing ≥99% purity confirmed by third-party HPLC/MS.

In his next series of experiments, Marcus applied reconstituted LL-37 5mg Peptide to biofilm-laden keratinocyte cultures and diabetic-mimicking wound models. The results stunned the team: bacterial load dropped dramatically within hours, inflammatory cytokine profiles shifted toward resolution, and scratch assays showed accelerated closure rates—up to 40% faster than controls in some replicates. Angiogenesis markers spiked, with tube formation assays revealing robust endothelial network development.

Marcus's paper, later accepted in a high-impact journal on wound biology, credited the LL-37 5mg Peptide as the pivotal reagent that bridged antimicrobial defense and regenerative signaling. His lab secured renewed funding, and the story spread through research networks. Today, Marcus still keeps a framed photo of that first successful assay plate on his desk—a reminder that sometimes the smallest molecule delivers the biggest shift.

Have you experienced a similar "turning point" reagent in your own research? What compound unexpectedly unlocked progress in your models?

What Exactly Is the LL-37 5mg Peptide?

The LL-37 5mg Peptide is a synthetic recreation of the C-terminal 37-amino-acid fragment of human cathelicidin (hCAP-18/LL-37), one of the few cathelicidins expressed in humans. This amphipathic, α-helical peptide is naturally produced by neutrophils, epithelial cells, keratinocytes, and certain lymphocytes as part of the innate immune response.

In research settings, the LL-37 5mg Peptide arrives as a sterile, white lyophilized powder in 5mg vials—perfect for multiple assays, dose-response curves, or extended protocols without constant reordering. Key specifications include:

  • Purity: ≥99% (third-party verified via HPLC and Mass Spectrometry)
  • Form: Lyophilized for stability during shipping and storage
  • Molecular Weight: ~4.5 kDa
  • Sequence: [LL-37, 37 aa]
  • Storage Recommendation: -20°C long-term; 2-8°C after reconstitution with bacteriostatic water or PBS
  • COA: Batch-specific analytical report included with every order

Unlike many research compounds limited to one function, LL-37 5mg Peptide exhibits remarkable multifunctionality. It directly disrupts microbial membranes via carpet-like or toroidal pore mechanisms, inhibits biofilm formation, modulates immune cell chemotaxis, promotes angiogenesis through pathways like FPRL1/VEGFR2 signaling, and influences wound re-epithelialization by activating EGFR and other receptors.

These properties make the LL-37 5mg Peptide a versatile probe for studying innate immunity, infectious disease models, chronic inflammation, tissue repair, and even autoimmune pathway dysregulation (where dysregulated LL-37 expression has been implicated).

Why Researchers Are Turning to LL-37 5mg Peptide in 2026

The "why" is straightforward yet profound: modern research demands tools that mirror complex biological realities. Antibiotics face rising resistance; chronic wounds affect millions with limited options; and understanding host-pathogen-immune crosstalk requires compounds that act at multiple levels.

The LL-37 5mg Peptide addresses these challenges head-on. In vitro and animal model studies consistently demonstrate its ability to:

  • Exert broad-spectrum antimicrobial effects against Gram-positive, Gram-negative bacteria, fungi, and certain viruses
  • Disrupt established biofilms—a major barrier in chronic infection models
  • Accelerate wound closure by enhancing keratinocyte migration, fibroblast activity, and collagen deposition
  • Stimulate angiogenesis, improving perfusion in ischemia or diabetic models
  • Modulate inflammation: pro-inflammatory at high concentrations to recruit immune cells, anti-inflammatory at physiological levels to resolve responses
  • Influence adaptive immunity by promoting dendritic cell maturation and T-cell responses

Sourcing from Cali BioLabs Peptides adds compelling reasons: USA-based manufacturing in certified facilities, fast domestic shipping (often same/next-day processing), free shipping thresholds, secure checkout, and unwavering research-only compliance. Why risk variable purity or delayed delivery when you can have guaranteed quality?

How to Work with LL-37 5mg Peptide in the Lab

Reconstitution and handling of the LL-37 5mg Peptide are straightforward but require precision to preserve activity.

  1. Preparation: Allow the vial to equilibrate to room temperature to avoid condensation.
  2. Reconstitution: Add 1-2 mL bacteriostatic water, sterile PBS, or culture medium-compatible solvent. Gently swirl—never vortex vigorously to prevent aggregation or loss of helical structure.
  3. Concentration: Common stock solutions range from 1-10 mg/mL; dilute further for working concentrations (typically 0.1-10 μM in cell culture or 1-50 μg/mL in antimicrobial assays).
  4. Storage: Use immediately for short-term experiments or aliquot and freeze at -80°C. Avoid repeated freeze-thaw cycles.
  5. Application Examples:
    • Antimicrobial assays: Add to bacterial cultures (MIC determination, time-kill curves)
    • Wound models: Incorporate into scratch assays, 3D skin equivalents, or ex-vivo human skin explants
    • Angiogenesis: Tube formation on Matrigel with endothelial cells
    • Immunomodulation: Treat monocyte/macrophage or dendritic cell cultures to assess cytokine profiles

Always use sterile technique, appropriate PPE, and dispose according to lab protocols. Detailed handling guides are available on the product page at calibiolabpeptides.com.

Key Advantages of LL-37 5mg Peptide – A Researcher’s Checklist

Here’s a concise list of why the LL-37 5mg Peptide frequently tops wish lists:

  • Broad-spectrum activity against resistant pathogens in lab models
  • Dual antimicrobial + pro-regenerative effects for complex wound/infection studies
  • Biofilm disruption capabilities—critical for chronic disease simulations
  • Angiogenic promotion without exogenous VEGF in many models
  • Immunomodulatory versatility: chemotaxis, cytokine regulation, and adaptive bridge
  • High stability when properly handled; long shelf-life lyophilized
  • 5mg size ideal for pilot studies through full experimental series
  • Third-party COA transparency reducing experimental variability
  • Fast, discreet USA shipping from a trusted research supplier
  • Strict research-only focus aligning with IRB and funding requirements

This combination of potency, multifunctionality, and reliability explains its growing popularity.

Frequently Asked Questions About LL-37 5mg Peptide

Q: What makes LL-37 different from other antimicrobial peptides? A: Its human origin reduces immunogenicity concerns in models, and its dual antimicrobial/regenerative roles set it apart from purely lytic peptides.

Q: Is LL-37 stable in culture media? A: Moderately—serum can reduce half-life due to proteases, so protease inhibitors or serum-free conditions are often used in long incubations.

Q: Can I use LL-37 5mg Peptide for in vivo animal studies? A: Yes, in approved protocols—common routes include topical, subcutaneous, or intraperitoneal, with doses typically 1-100 μg/kg depending on model.

Q: How does LL-37 compare to synthetic analogs or shorter fragments? A: Full-length LL-37 retains the broadest activity; fragments may offer improved stability or reduced cytotoxicity but lose some multifunctional potency.

Q: What if my vial arrives compromised? A: Contact Cali BioLabs Peptides support immediately—replacements are provided for verified issues.

Q: Is LL-37 suitable for studying autoimmune models? A: Yes—elevated LL-37 is implicated in conditions like psoriasis and lupus, making it valuable for pathway dissection.

What Breakthrough Could LL-37 5mg Peptide Enable in Your Lab Next?

As we close this exploration, consider this: With rising antibiotic resistance, persistent chronic wounds, and the quest for better infection-healing balance, what specific question could the LL-37 5mg Peptide help you answer? Perhaps dissecting biofilm-immune evasion, optimizing angiogenic therapies, or modeling innate-adaptive crosstalk?

Share your research ideas or current challenges—the scientific community thrives on these exchanges.

In summary, the LL-37 5mg Peptide from Cali BioLabs Peptides is more than a research reagent—it's a window into one of nature's most elegant defense systems. High purity, reliable supply, and unmatched multifunctionality make it an essential addition for labs pushing boundaries in 2026.

Order your LL-37 5mg Peptide today at Cali BioLab Peptides and elevate your experiments with confidence.

 



How One Peptide Ignites the Hypothalamic GnRH Pulse Generator

Imagine a single peptide acting as the upstream "on" switch for the entire reproductive cascade—triggering pulsatile release of GnRH from hypothalamic neurons, cascading into LH and FSH secretion from the pituitary, and ultimately driving gonadal steroidogenesis and gametogenesis—all in a tightly regulated, physiological manner. In laboratory models, researchers are probing exactly this pivotal role with the Kisspeptin-10 10mg Peptide, the minimal bioactive fragment of the KISS1 gene product that's revolutionized our understanding of puberty onset, fertility maintenance, and neuroendocrine control of reproduction.

As the shortest fully active form of kisspeptins (a family of RFamide peptides), Kisspeptin-10 binds with high affinity to its cognate receptor GPR54 (KISS1R), directly depolarizing GnRH neurons and eliciting robust gonadotropin release without bypassing the natural hypothalamic gatekeeper. Available in a 10mg lyophilized vial from Cali BioLab Peptides, the Kisspeptin-10 10mg Peptide offers ≥99% purity, third-party HPLC/MS verification, batch-specific COAs, and fast USA domestic shipping—providing qualified researchers with a precise, high-fidelity tool to interrogate the kisspeptin-GnRH axis in reproductive endocrinology, hypothalamic signaling, sexual dimorphism studies, and fertility disorder models.

If your investigations target GnRH pulsatility, LH/FSH dynamics, puberty mechanisms, hypogonadism analogs, or comparative neuroendocrine pathways, the Kisspeptin-10 10mg Peptide could unlock deeper insights into one of biology's most conserved reproductive regulators. Let's dive into the mechanisms, lab stories, and research advantages fueling its prominence in 2026.

Strict Disclaimer: For laboratory and scientific research use only. Not for human consumption, therapeutic, diagnostic, veterinary, or any non-research applications. Strictly intended for qualified researchers conducting in-vitro, ex-vivo, or ethically approved animal model studies. Cali BioLab Peptides upholds full regulatory compliance.

The Puberty Reset: Dr. Sofia's Hypogonadotropic Model That Restored Fertility

In a reproductive neuroendocrinology lab at a prominent European university, Dr. Sofia Moreau was investigating models of hypogonadotropic hypogonadism induced by Kiss1r knockout or chronic stress paradigms in mice. These animals exhibited absent or severely blunted LH pulses, undetectable testosterone/estradiol, anovulation, and complete infertility—perfectly recapitulating human idiopathic hypogonadism but resistant to standard interventions.

Sofia had followed the seminal work establishing kisspeptin as the essential upstream regulator of GnRH neurons. She decided to test restoration with the minimal active fragment and ordered the Kisspeptin-10 10mg Peptide from Cali BioLab Peptides. The vial arrived lyophilized and pristine, with COA confirming 99.6% purity and excellent stability.

In her protocol, Sofia administered subcutaneous boluses or short infusions (scaled ~10-100 nmol/kg) to Kiss1r-intact but suppressed mice. Within minutes, LH surged dramatically (often 5-10 fold baseline), followed by robust FSH release and rapid rises in gonadal steroids. Chronic intermittent dosing restored pulsatile GnRH patterns (via serial sampling), normalized estrous cyclicity, induced ovulation, and achieved fertility in previously infertile cohorts—demonstrating that exogenous Kisspeptin-10 could bypass upstream deficits and directly drive the GnRH pulse generator.

Sofia's publication in a leading endocrinology journal highlighted Kisspeptin-10 10mg Peptide as a powerful probe for dissecting GnRH neuronal activation thresholds and sexual dimorphism in gonadotropin responses, securing new grants and collaborations. The peptide became a core reagent in her group's fertility restoration studies.

Has a targeted upstream regulator ever unexpectedly rescued reproductive competence in one of your neuroendocrine or hypogonadism models?

What Exactly Is the Kisspeptin-10 10mg Peptide?

The Kisspeptin-10 10mg Peptide (also designated Kp-10 or metastin fragment) is the shortest fully bioactive form of the kisspeptin family, consisting of the C-terminal 10 amino acids of the KISS1 gene product. It serves as the minimal sequence retaining full potency at the G-protein-coupled receptor GPR54/KISS1R.

Key specifications:

  • Quantity: 10mg sterile lyophilized powder per vial—ideal for acute boluses, infusion protocols, dose-response curves, or multi-day paradigms
  • Purity: ≥99% (third-party verified by HPLC and Mass Spectrometry)
  • Sequence: Tyr-Asn-Trp-Asn-Ser-Phe-Gly-Leu-Arg-Phe-NH₂ (amidated C-terminus)
  • Molecular Formula: C₆₃H₈₃N₁₇O₁₄
  • Molecular Weight: ≈1302.4 Da
  • Form: White, sterile lyophilized solid optimized for reconstitution
  • Storage: -20°C long-term; 2-8°C after reconstitution with bacteriostatic water or PBS
  • COA: Full batch-specific analytical report included

In research settings, Kisspeptin-10 10mg Peptide binds GPR54 on GnRH neurons, activating Gq/PLC pathways, mobilizing intracellular calcium, and triggering immediate GnRH release. This elicits rapid, dose-dependent LH and FSH secretion from the pituitary, with effects more pronounced on LH in many models. It resets GnRH pulse frequency and amplitude, making it invaluable for studying reproductive axis control.

Here are professional examples of Kisspeptin-10 research-grade lyophilized vials in sterile glass packaging, showcasing the clean, high-quality presentation typical for lab-grade peptides:

Checkout other nasal sprays like  Semax 10mg Peptide ,  Selank 5mg Peptide . 

Why Researchers Rely on Kisspeptin-10 10mg Peptide for Reproductive Neuroendocrinology

Kisspeptin-10's position as the gatekeeper of GnRH secretion makes it uniquely suited to probe upstream regulation without downstream artifacts. Preclinical and mechanistic insights include:

  • Potent stimulation of GnRH release and gonadotropin secretion (often more LH-selective)
  • Restoration of pulsatile patterns in hypogonadotropic or suppressed models
  • Sexual dimorphism in responses (stronger LH surges in males in some studies)
  • Utility in puberty onset, fertility maintenance, and infertility analog models
  • Investigation of hypothalamic clock resetting and pulse generator dynamics
  • Potential synergy or comparison with GnRH analogs, GHRH, or other neuropeptides

Sourcing from Cali BioLab Peptides ensures USA-manufactured quality, fast domestic shipping (same/next-day processing), secure checkout, and strict research-only compliance—critical for reproducible, IRB-aligned work.

How to Work with Kisspeptin-10 10mg Peptide in the Lab

Reconstitution protocol:

  1. Allow vial to reach room temperature.
  2. Add 1-2 mL bacteriostatic water or sterile PBS; gently swirl to dissolve.
  3. Prepare stock solutions (e.g., 1-5 mg/mL) and dilute for working concentrations (typically 1-100 nmol/kg in vivo or nM ranges in vitro).
  4. Aliquot and freeze at -80°C for long-term use.

Applications include:

  • Acute GnRH/LH stimulation tests in pituitary cultures or animal models
  • Pulsatile or continuous infusion to mimic endogenous patterns
  • Behavioral fertility endpoints (estrous cyclicity, mating success)
  • c-Fos mapping or calcium imaging in GnRH neurons

Always use sterile technique and ethical oversight.

Advantages of Kisspeptin-10 10mg Peptide – A Researcher's Checklist

  • Direct activation of GnRH neurons for upstream axis studies
  • Physiological pulsatile gonadotropin release
  • High potency with minimal sequence (ideal for mechanistic dissection)
  • Sexual dimorphism and pulse frequency modulation insights
  • High purity and batch transparency reducing variability
  • 10mg size supporting acute through sub-chronic protocols
  • Excellent solubility and stability in aqueous buffers
  • USA-sourced, rapid shipping, dedicated support
  • Strict research-only designation for compliance

Frequently Asked Questions About Kisspeptin-10 10mg Peptide

Q: How does Kisspeptin-10 differ from longer forms like Kisspeptin-54? A: Kisspeptin-10 is the minimal bioactive fragment with equivalent receptor affinity and potency in many assays; shorter half-life but often preferred for precise bolus studies.

Q: What dosing is typical in preclinical literature? A: In-vivo boluses often 10-100 nmol/kg subcutaneously or intravenously; infusions scaled accordingly.

Q: Is it GnRH-dependent in models? A: Yes—effects are abolished by GnRH antagonists, confirming action via GnRH neuron stimulation.

Q: Suitable for female reproductive models? A: Yes—stimulates LH/FSH and supports ovulation/fertility in rodent analogs.

Q: Stability post-reconstitution? A: Stable for weeks refrigerated; freeze aliquots for longer storage.

Q: How to verify batch purity? A: Match the provided COA on the product page.

What Reproductive Axis Question Could Kisspeptin-10 10mg Peptide Help You Answer?

With ongoing interest in central regulation of fertility and puberty disorders, what specific GnRH pulse dynamic, sexual dimorphism, or infertility mechanism might the Kisspeptin-10 10mg Peptide illuminate in your research? Could it refine models of hypogonadism or reveal novel regulatory interactions?

Share your perspective—the dialogue advances discovery.

In summary, the Kisspeptin-10 10mg Peptide from Cali BioLab Peptides is a potent, minimal-sequence probe for the kisspeptin-GnRH axis. With exceptional purity, reliable supply, and proven utility in reproductive neuroscience, it's ready to power your 2026 breakthroughs.

Order your Kisspeptin-10 10mg Peptide today at https://www.calibiolabpeptides.com/ and activate the reproductive master switch in your experiments with confidence.



Semax + Selank Cognitive Nootropic Stack – High-Purity Research Bundle

The Cognitive Nootropic Stack combines two of the most studied research peptides, Semax and Selank, each supplied in either 5mg or 10mg vials with optional bacteriostatic mixing water. This pairing has attracted research interest for its potential influence on cognitive function, memory performance, mood regulation, and neuroprotection.

Both compounds are supplied as lyophilised (freeze-dried) solids to ensure long-term stability. Each batch is verified at >99.1% purity (HPLC-tested) and provided with full Certificates of Analysis (COAs).


What is the Cognitive Nootropic Stack?

  • Semax – A synthetic derivative of ACTH fragments, investigated for its effects on brain-derived neurotrophic factor (BDNF), synaptic plasticity, and potential neuroprotection.

  • Selank – A synthetic analogue of tuftsin, researched for its anxiolytic, cognitive, and immune-modulating properties without sedative effects.

Together, these peptides form a complementary nootropic stack for advanced laboratory research into brain function and neurobiology.


Scientific Identifiers

Semax 5mg/10mg

  • CAS Number: 80714-61-0

  • Molecular Formula: C₃₇H₅₁N₉O₁₀S

  • Molecular Weight: 813.92 g/mol

  • Form: Lyophilised Solid

  • Purity: >99.1% (HPLC Verified)

  • Storage: Store refrigerated or at −20°C, protected from light

Selank 5mg/10mg

  • CAS Number: 129954-34-3

  • Molecular Formula: C₃₃H₅₇N₁₁O₉

  • Molecular Weight: 751.87 g/mol

  • Form: Lyophilised Solid

  • Purity: >99.1% (HPLC Verified)

  • Storage: Store refrigerated or at −20°C, protected from light

Optional Mixing Water

  • Volume: 10ml

  • Type: Bacteriostatic Water (with preservative)

  • Use: For peptide reconstitution


Usage and Reconstitution

The peptides in this stack are supplied in freeze-dried form to preserve stability. For laboratory research, they may be reconstituted with bacteriostatic water or another suitable solvent according to established protocols. For detailed instructions, refer to our peptide reconstitution guide.


Research Applications of the Cognitive Nootropic Stack

Semax

  • Nootropic Action – Studied for cognitive enhancement, memory support, and learning.

  • Neuroprotection – Investigated for protective effects in models of ischemia and oxidative stress.

  • Mood Modulation – Explored for influence on dopamine and serotonin systems.

Selank

  • Anxiolytic Effects – Researched for calming and anti-anxiety activity.

  • Cognitive Support – Studied for improvements in focus, attention, and memory.

  • Immune Regulation – Explored for roles in immune system modulation.

References available on request or in our research archive.


Why Order the Cognitive Nootropic Stack from Bluewell Peptides?

  • 99.1% purity, HPLC-verified

  • COA provided with every batch

  • Secure ordering and fast USA delivery

  • Transparent, research-focused supplier

  • Excellent customer support and trusted reviews



#

Free home delivery

Provide free home delivery for all product over $200 and Timely Delivery

#

Quality Products

We ensure the product quality that is our main goal

#

30 Days Return

Return product within 30 days for any product you buy and

#

Online Support

We ensure the product quality that you can trust easily